- KSR2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83553
- KSR2
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: LPASHYYKYK QQFIFPDVVP VPETPTRAPQ VILHPVTSNP ILEGNPLLQI EVEPTSENEE VHDEAEESED DFEEMNLSLL S
- 0.1 ml (also 25ul)
- Rabbit
- Human
- kinase suppressor of ras 2
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Protein Kinase
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
LPASHYYKYKQQFIFPDVVPVPETPTRAPQVILHPVTSNPILEGNPLLQIEVEPTSENEEVHDEAEESEDDFEEMNLSLLS
Specifications/Features
Available conjugates: Unconjugated